Scaffold Ga0183100_1032996

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0183100_1032996

Scaffold Ga0183100_1032996

Overview

Basic Information
Taxon OID	3300016722 Open in IMG/M
Scaffold ID	Ga0183100_1032996 Open in IMG/M
Source Dataset Name	Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	916
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location
Location Name	Lawrence Berkeley National Laboratory, California, USA
Coordinates	Lat. (^o)	37.8754404	Long. (^o)	-122.2477251	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051098	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183100_10329961	F051098	GGA	MIITPFYYRRNCRKLYPGNKVEIGNATIDKLVSAARYTLGSQDHVFRIGRKVIQLSDLHHCNGHEVGLANFTKIQITKEEKE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.