Scaffold Ga0183100_1006882

Overview

Basic Information

• Taxon OID: 3300016722
• Scaffold ID: Ga0183100_1006882
• Source Dataset Name: Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3141
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location

• Location Name: Lawrence Berkeley National Laboratory, California, USA
• Coordinates
  • Lat. (^o): 37.8754404
  • Long. (^o): -122.2477251

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051098	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0183100_10068823	F051098	GAG	MIITPFYYCRNCRKLYPGNKVEISHAPIEKLVSAACYTLGSQDHIFRIGGKVIQLSDLHHCNDHEIGLANFIKIQIDKEEKE