Scaffold Ga0180039_1102753

Overview

Basic Information

• Taxon OID: 3300016688
• Scaffold ID: Ga0180039_1102753
• Source Dataset Name: Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1231
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.008
  • Long. (^o): -89.701
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082064	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180039_11027533	F082064	N/A	LTNVVTAINWVCTGTNGLVTSSSSGTVQLGTPNPAEFVPYADITQEMAFQWVSQSISITGVEAAIAAQINQISTPQVQPQNPPF