NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180042_117152

Scaffold Ga0180042_117152


Overview

Basic Information
Taxon OID3300016683 Open in IMG/M
Scaffold IDGa0180042_117152 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)684
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Madison
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001560Metagenome / Metatranscriptome670Y

Sequences

Protein IDFamilyRBSSequence
Ga0180042_1171521F001560N/APRFSGNFEDLAWFRQAWETHVQQFHHEVAPEALVGGMRKFCMPRGLSRMIEAARNPEEAWRMLKSYFDRETGMLDRSIEEILSHGRMVNDSQTLAHYSRILMAIRDAKQIGRLSDLLTDERIGALMERVPRKENGYWGCDLKGVRPKDRPVVFYSFVRFRALELGSNTAPFRFQLKDPEELEPAWEGPCLMGDLCGGSHVPEECDLFIGMSQRDRLAVVARKRLCYLC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.