NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0132256_100443369

Scaffold Ga0132256_100443369


Overview

Basic Information
Taxon OID3300015372 Open in IMG/M
Scaffold IDGa0132256_100443369 Open in IMG/M
Source Dataset NameSoil combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1405
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUSA: Bethesda, Maryland
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073203Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0132256_1004433693F073203N/APPLSGPSRTFVFDHELTYLVRDYTKRSRIVLYDNGAFVLGYDGLGDYRGGYTESNGLIRFDWEGWSVAGPWGASGTLEKRSLTIQFNFIMQLTDFEDAVYLLAPS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.