Scaffold Ga0132256_100282414

Overview

Basic Information

• Taxon OID: 3300015372
• Scaffold ID: Ga0132256_100282414
• Source Dataset Name: Soil combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1739
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Trichocoleusaceae → Trichocoleus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: USA: Bethesda, Maryland
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037211	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0132256_1002824141	F037211	N/A	AMPLDLEKVAEVLVALMISSSVLIVAAAIAWRLAVKPTLQALGETRTARAGAEPVLSRRVSELEDAVRGLSDKLAALPEGNPSRLTAELPWRGTKEKI*