NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0132256_100155216

Scaffold Ga0132256_100155216


Overview

Basic Information
Taxon OID3300015372 Open in IMG/M
Scaffold IDGa0132256_100155216 Open in IMG/M
Source Dataset NameSoil combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2301
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUSA: Bethesda, Maryland
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008789Metagenome / Metatranscriptome328Y
F029837Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0132256_1001552163F029837GGAMKTLITALGFAIVIVAPGFTEPADARAAARKTEPADSCLCGQNEKCYWWGQCAIINDENTRFHD*
Ga0132256_1001552165F008789GGAGMKALIAALALATLIASPTFARPAARASPQAEFVFPTDQELCQSGRTDFCHWRGYPLWQWYSGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.