Scaffold Ga0132258_12267234

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0132258_12267234

Scaffold Ga0132258_12267234

Overview

Basic Information
Taxon OID	3300015371 Open in IMG/M
Scaffold ID	Ga0132258_12267234 Open in IMG/M
Source Dataset Name	Combined assembly of cpr5 and col0 rhizosphere and soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1362
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location Name	University of North Carolina
Coordinates	Lat. (^o)	35.9	Long. (^o)	-79.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013828	Metagenome / Metatranscriptome	268	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0132258_122672341	F013828	AGG	MKKWRYRVALPFMMSLSGCIEITTYLSPSASGTVIDAASKKPVQGATISVDDHPGLFAQTNSDGQFLLVPATRKTRIFVLAPYRSLPPGGTVVVSADGYASREIVVKGSADSLLVSLVRVR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.