Scaffold Ga0182007_10423419

Overview

Basic Information

• Taxon OID: 3300015262
• Scaffold ID: Ga0182007_10423419
• Source Dataset Name: Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 510
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location

• Location Name: USA: Nebraska
• Coordinates
  • Lat. (^o): 41.1591
  • Long. (^o): -96.4086

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072772	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182007_104234191	F072772	GGA	MKICKEGVAVRRLDEHRYAMSVDQVIRYVGSQEECERRAAILLPKNSRDMQDRALARVCQMG*