Scaffold Ga0167626_1002702

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167626_1002702

Scaffold Ga0167626_1002702

Overview

Basic Information
Taxon OID	3300015204 Open in IMG/M
Scaffold ID	Ga0167626_1002702 Open in IMG/M
Source Dataset Name	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2B, Ice surface)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10639
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (81.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Russell Glacier, Kangerlussuaq, Greenland
Coordinates	Lat. (^o)	67.163011	Long. (^o)	-50.018445	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065203	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167626_10027021	F065203	N/A	MLDMRVTEWLTRLGGNAPRLVSLGLAALIAVELARALIILLSGSPVKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.