NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167627_1006882

Scaffold Ga0167627_1006882


Overview

Basic Information
Taxon OID3300015196 Open in IMG/M
Scaffold IDGa0167627_1006882 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5517
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell Glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.163069Long. (o)-50.018284Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083559Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0167627_10068823F083559AGGMNDCAVSDALTHPPSSRPPRPALVDLHILPHTIHEFGVEARKAGKSWEAAFNGPIQSWEDPETQQATYGVTVRLSRIKDPFTRELYSTNILFYLPEDAMHGMHNVYDMAQRFPFTRIRGPRTAPPLCPPRAGMLWYDANPEGVIMEDVRQSPAMLPDGRPGFFVTGQGYRGKVVLPDGLFIHDVGVYGGYLDPLERPAQLELQHLFGGIEFMPGKTGTQEDLFLTELGDGVWVKGIVGNAVDELHVESYKNSVRLPCPHAGKFLIGARSMSETKLLPYFESRDPNGLGSYALSGFVDCLPKAIGPDVWERVHRVGLGSNFIPSPEIGGHIGLIHVVLERNNPDYPETHDPSYPKIEEQYEGWVVWLDFDESGTPHVKSCLRALTPDDVPRCYQGAGELFDTKRVAFPISLYRIGDNLRVGYGWGDRALFQAEYDYQTVVRHLAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.