NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167666_1037452

Scaffold Ga0167666_1037452


Overview

Basic Information
Taxon OID3300015194 Open in IMG/M
Scaffold IDGa0167666_1037452 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1238
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRabots glacier, Tarfala, Sweden
CoordinatesLat. (o)67.907119Long. (o)18.447522Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017937Metagenome / Metatranscriptome238Y

Sequences

Protein IDFamilyRBSSequence
Ga0167666_10374521F017937N/AMIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWGWTGFAG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.