Basic Information | |
---|---|
Taxon OID | 3300015193 Open in IMG/M |
Scaffold ID | Ga0167668_1009360 Open in IMG/M |
Source Dataset Name | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2212 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rabots glacier, Tarfala, Sweden | |||||||
Coordinates | Lat. (o) | 67.872223 | Long. (o) | 16.713705 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F079527 | Metagenome / Metatranscriptome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167668_10093603 | F079527 | N/A | MQTTAIPPGPAEGFDLGGSEESLALMRRCFAQYGDVYRIFAPSRGVYN |
⦗Top⦘ |