NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167646_1009529

Scaffold Ga0167646_1009529


Overview

Basic Information
Taxon OID3300015192 Open in IMG/M
Scaffold IDGa0167646_1009529 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2729
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameStorglaci?ren, Tarfala, Sweden
CoordinatesLat. (o)67.899243Long. (o)18.344347Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017686Metagenome / Metatranscriptome239Y
F055303Metagenome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0167646_10095292F017686GAGGMSQMRSTAATKPSPIPDETARLFQVALHDVVRSSALSMAELRECVKACVGTLRDTNVGPAQMIISMKACAKEGTRRYPQTLNDHELSNADFLMDQIIKWAIVEYYSDA*
Ga0167646_10095293F055303N/AVVTSTGRFWRRLSLFKAPQMSRPPDLTPSHLPEELDRALRGATDRTLVALTALRKAVRQHVQDERERGATLPDIEIELRTIITRVLKDAAGRDSVDGERDALANQMMKWSAGFYNHND*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.