Scaffold Ga0167667_1008300

Overview

Basic Information

• Taxon OID: 3300015189
• Scaffold ID: Ga0167667_1008300
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3190
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Rabots glacier, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.906846
  • Long. (^o): 18.44555
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013424	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167667_10083002	F013424	AGGAGG	MAQGGGKAPKQITWIICLVLYVVALLAHFRVVSVSADVAVWSWIIGFGLLLVAVRLRGL*