Scaffold Ga0120098_1002058

Overview

Basic Information

• Taxon OID: 3300015170
• Scaffold ID: Ga0120098_1002058
• Source Dataset Name: Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Harvard University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1723
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill → Fossil Microbial Communities From Human Bone And Soil Samples From Teposcolula Yucundaa, Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Teposcolula Yucundaa
• Coordinates
  • Lat. (^o): 17.550556
  • Long. (^o): -97.425556

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050288	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120098_10020584	F050288	N/A	RIFDFLNSRNARMSCPFCSQEVWEGADERVVLSHAPGGDAMDRRTEALLLTCANCGFIRFQSAHVLDDPRGQ*