Scaffold Ga0120098_1000394

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120098_1000394

Scaffold Ga0120098_1000394

Overview

Basic Information
Taxon OID	3300015170 Open in IMG/M
Scaffold ID	Ga0120098_1000394 Open in IMG/M
Source Dataset Name	Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Harvard University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3211
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill → Fossil Microbial Communities From Human Bone And Soil Samples From Teposcolula Yucundaa, Mexico

Source Dataset Sampling Location
Location Name	Mexico: Teposcolula Yucundaa
Coordinates	Lat. (^o)	17.550556	Long. (^o)	-97.425556	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014009	Metagenome / Metatranscriptome	266	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120098_10003943	F014009	N/A	VTAARYRYCPWCAAPQRRKLVEFFVGADRDSGRALRVSRYLPERRVRFSVWDESGTARAAVSLDEEEAARLAAFVAPQPEARPSILDELRAFVRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.