Scaffold Ga0167665_1000298

Overview

Basic Information

• Taxon OID: 3300015163
• Scaffold ID: Ga0167665_1000298
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17629
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (52.94%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Rabots glacier, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.907119
  • Long. (^o): 18.447522
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076730	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167665_100029812	F076730	N/A	MSAPIRGVGAAASLNHDGPEDPDFATVDLCLFAQLADQRVCDPQPPSTSVRVERSKLSAVELSVQMSLRLSRPPTGPRLEAWERIAAELAARGIQAEPADLHMMRFTVSPDDELRAAQAVVWPA*