Scaffold Ga0167653_1053093

Overview

Basic Information

• Taxon OID: 3300015162
• Scaffold ID: Ga0167653_1053093
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 716
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Storglaci?ren, Tarfala, Sweden
• Coordinates
  • Lat. (^o): 67.900879
  • Long. (^o): 18.43474
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000389	Metagenome / Metatranscriptome	1198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167653_10530932	F000389	AGGAG	MFRFDQLIRRDTIIRDVKQRHPLTVEVFESLKFRSPCDDCTIETVARKNGLNVLDVVESLNQAAFGPRQDGDHAGQTVA*