Scaffold Ga0167623_1000825

Overview

Basic Information

• Taxon OID: 3300015161
• Scaffold ID: Ga0167623_1000825
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11989
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (47.06%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell Glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.156516
  • Long. (^o): -50.06387

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070394	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167623_10008254	F070394	N/A	MTFRVRIDPVALRHIDEFAAYLRDYSEEFAIEQIERLDRIIAVNLGESPLTWSYFAFTGAPYRAYLFRVGRRTQFCIIYTVDEESRTVDILHFWNAMRVPERLELF*