NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167634_1043103

Scaffold Ga0167634_1043103


Overview

Basic Information
Taxon OID3300015090 Open in IMG/M
Scaffold IDGa0167634_1043103 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)632
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.15642Long. (o)-50.083651Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010937Metagenome297Y

Sequences

Protein IDFamilyRBSSequence
Ga0167634_10431031F010937N/AELADMRGIGAAAFSLALLAIVLHAFALGGVLGTLREPSASLVTFGREGMRRMPAFLVFTFAAFGAAFAAYEWIYVKSGEALRDRVRELHTEQAALAVTALRLLALLAALAVIKLLADSVRVVWVARPDLPPVSRFFFGIGGALARPLRLLGVVGIYTLVTAGLYIAWLVIDPSAGGEARFALAPLILSQQVFVFIRLLIKVGYYAGISEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.