Scaffold Ga0167634_1000069

Overview

Basic Information

• Taxon OID: 3300015090
• Scaffold ID: Ga0167634_1000069
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7896
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. Fw109-5 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.15642
  • Long. (^o): -50.083651
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100049	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167634_10000696	F100049	N/A	MRPAPENAQRIYLRSGQDGDPLAFSVRWFVPSGFDAGGIPEVASHAMGKVELTSCLTLLGVTALGVMVGDVMDGTPVFDFRPCSPLEAAEHACREGQRSRGIAYSQTVYVEATPEELYRRLSLWESGRERWGR*