Scaffold Ga0167643_1011426

Overview

Basic Information

• Taxon OID: 3300015089
• Scaffold ID: Ga0167643_1011426
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1306
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.05702
  • Long. (^o): -50.459796

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038001	Metagenome / Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167643_10114263	F038001	N/A	GSRQVRTLSSLLRREVVTESGHSLGRCRDLSGELTATKLRVTGICVGRGALAEHLGIRPARAHTTIPWDAVVRIEGKRIVVRDDVR*