Scaffold Ga0167645_119754

Overview

Basic Information

• Taxon OID: 3300015068
• Scaffold ID: Ga0167645_119754
• Source Dataset Name: Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8C, Adjacent to main proglacial river, end of transect (Watson river))
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 626
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Russell glacier, Kangerlussuaq, Greenland
• Coordinates
  • Lat. (^o): 67.056923
  • Long. (^o): -50.459608
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043430	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167645_1197541	F043430	N/A	KVIDAVIKATGDSYDKVSRLCTVAHETVDECLTDDISVVAPPLVIGRLGCPVLDRLLLRLGDGQWQLPESVDVTEPELAETLMLPIETIARYPMIGRFGLLARCMDRLLIEDADAERSLAILDSWLSMYVPAADGTPSPYQVWGLPNRDTFEGWLLARLDLLHSLGYAVRLANEEMDGVRGQQHMFVDGRRADLLMRFAADCDKGAAD