Basic Information | |
---|---|
Taxon OID | 3300015048 Open in IMG/M |
Scaffold ID | Ga0180013_130445 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_J_MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 574 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: the Olkiluoto Island | |||||||
Coordinates | Lat. (o) | 61.2418 | Long. (o) | 21.4803 | Alt. (m) | Depth (m) | 410 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096722 | Metagenome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0180013_1304451 | F096722 | AGGA | MSDEKESYTGPIEQKVNSMMETTGDEISNFTQKGPDVFINETVQDIRILNLNRCILYLAKEIDKLAKSIK* |
⦗Top⦘ |