Basic Information | |
---|---|
Taxon OID | 3300014961 Open in IMG/M |
Scaffold ID | Ga0134526_1001357 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Freiburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 12789 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Freiburg | |||||||
Coordinates | Lat. (o) | 48.0 | Long. (o) | 8.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090513 | Metagenome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134526_10013574 | F090513 | GGA | MLKIFAMAKYVRKMEWKLLHIKHILYMRPFGALKIAPQSVGNKNGTKAVLQGWAAAFVPYMLSFT* |
⦗Top⦘ |