Scaffold Ga0134526_1001046

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134526_1001046

Scaffold Ga0134526_1001046

Overview

Basic Information
Taxon OID	3300014961 Open in IMG/M
Scaffold ID	Ga0134526_1001046 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Freiburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15502
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (81.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany

Source Dataset Sampling Location
Location Name	Germany: Freiburg
Coordinates	Lat. (^o)	48.0	Long. (^o)	8.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087334	Metagenome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134526_10010467	F087334	N/A	MASRYPFVGAAAHLFPKNAIKMLSFSTSGKGSILLYPFRSSPLLAITFLYHPKDFFLCRAAALFEYWEKHP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.