Scaffold Ga0164311_10728958

Overview

Basic Information

• Taxon OID: 3300014914
• Scaffold ID: Ga0164311_10728958
• Source Dataset Name: Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Gulf of California
• Coordinates
  • Lat. (^o): 27.0151
  • Long. (^o): -111.3798
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094884	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164311_107289582	F094884	AGGAG	MENNKLIGSTYVNIIKDEKGEIKFAYGYEINDEEVSLNDLAMLNSFLDKLKEQAQQDFNERLDKNDKEFSIESEKEGQNGE*