Scaffold Ga0164321_10688160

Overview

Basic Information

• Taxon OID: 3300014903
• Scaffold ID: Ga0164321_10688160
• Source Dataset Name: Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Subseafloor Sediment Microbial Communities From Guaymas Basin, Gulf Of California, Mexico

Source Dataset Sampling Location

• Location Name: Mexico: Gulf of California
• Coordinates
  • Lat. (^o): 27.009
  • Long. (^o): -111.4081
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088271	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164321_106881601	F088271	N/A	MQKAEIKQIADYLKDLEEGLVEWDYRGITTQGHLTKLYDIIERLMQATFETKDQELKPLLATLEYKARKCKQCIERRLAVKN*