NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180090_1078567

Scaffold Ga0180090_1078567


Overview

Basic Information
Taxon OID3300014866 Open in IMG/M
Scaffold IDGa0180090_1078567 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)587
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9223Long. (o)-106.9517Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000926Metagenome / Metatranscriptome832Y
F067246Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0180090_10785671F000926GGALEVLVRTAVFKSANALVGWLLQQAADRVDAHYQPNARQTRKSRETIGVQGIFGCFQLQRDYYYHEGKDQGHYPVDAALGLEVGYTPALAKLVCLEGADEPTYQKAERHLEQTG
Ga0180090_10785672F067246N/ANHTRHVSADELPAVQSALAGYAQFRQLTEKYADLVIQETRQNIAGSKKNQSRPKSSSPKKKKSSN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.