Scaffold Ga0182030_10000491

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182030_10000491

Scaffold Ga0182030_10000491

Overview

Basic Information
Taxon OID	3300014838 Open in IMG/M
Scaffold ID	Ga0182030_10000491 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	74457
Total Scaffold Genes	77 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	42 (54.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Stordalen
Coordinates	Lat. (^o)	68.35	Long. (^o)	19.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005269	Metagenome / Metatranscriptome	406	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182030_1000049138	F005269	GAG	VNGFSLTRDDHSASYAIIRHNVRTYRSDGVVEVVRGKQNAESELKKIEESQRDPDRHEGWRYFIEKTDLKAGIDPTEATCRRQAELEVRESKEMQETKPPFTPPASSQR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.