Basic Information | |
---|---|
Taxon OID | 3300014810 Open in IMG/M |
Scaffold ID | Ga0119896_1049743 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_IW_meta |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Nanjing University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 570 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Nanjing | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019998 | Metagenome / Metatranscriptome | 226 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119896_10497432 | F019998 | N/A | VGFTTLAWQPLRIIEARRVDLSSDIEVPLMIVGKFDYERIPNKAMTSIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYGLAARLGDEFPIDPQRQAMLEQKAAGYFTAMRQAYSGNASVKFGVRG* |
⦗Top⦘ |