NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119946_1017991

Scaffold Ga0119946_1017991


Overview

Basic Information
Taxon OID3300014801 Open in IMG/M
Scaffold IDGa0119946_1017991 Open in IMG/M
Source Dataset NameAquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNanjing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)726
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment System In Nanjing, China

Source Dataset Sampling Location
Location NameChina: Nanjing
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009126Metagenome / Metatranscriptome322N
F041737Metagenome159N

Sequences

Protein IDFamilyRBSSequence
Ga0119946_10179911F009126N/AMAITVLSGSPQAATPVYNKMLYKVSGSLTSATNYRYVCDVKDAAGTTTLARLKCDKLPTTNYGFFDVSRVVETLIAPTVPTLTQTGFADHAGFYSGYRLTFMEEYGSTPVVQTGTTTNVTGNIAFAGNLEQLELADWSGGVYFPSNALQGGEKALTT
Ga0119946_10179912F041737N/AFKGNPIPIRPLQEWIAFKGIPLQGRDKQAANRSFAINIANKIRREGLKATNCMSNAVTEDMVAVLTENIAEVLGKSISVATVR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.