Scaffold Ga0134580_100289

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134580_100289

Scaffold Ga0134580_100289

Overview

Basic Information
Taxon OID	3300014741 Open in IMG/M
Scaffold ID	Ga0134580_100289 Open in IMG/M
Source Dataset Name	Human fecal microbial community from subjects in taly - 20007
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bologna
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4004
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Source Dataset Sampling Location
Location Name	Italy
Coordinates	Lat. (^o)	44.4950537	Long. (^o)	11.3427401	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090513	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134580_1002891	F090513	GGA	MLKIFAIAKYVRKMEWKLLHIKHILYRRPFGALKIAPQSVGNKNGTKAVLQGWAAAFVPYMLSFTYGNTA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.