Scaffold Ga0134314_101804

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134314_101804

Scaffold Ga0134314_101804

Overview

Basic Information
Taxon OID	3300014711 Open in IMG/M
Scaffold ID	Ga0134314_101804 Open in IMG/M
Source Dataset Name	Surface water microbial communities from Bangladesh - BaraHaldiaSW0111
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1586
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh

Source Dataset Sampling Location
Location Name	Bangladesh: Bara Haldia, Matlab upazilla
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051792	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134314_1018044	F051792	AGAAG	MNNKGYSRKFVDANLKADPLHVGVQLGRICIERDIPVLDVAEHLNVSRQAIYMWFLGKALPHPNKRKVLWELLDRLASTAAH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.