NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181525_10020325

Scaffold Ga0181525_10020325


Overview

Basic Information
Taxon OID3300014654 Open in IMG/M
Scaffold IDGa0181525_10020325 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4131
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009718Metagenome / Metatranscriptome314Y
F038327Metagenome / Metatranscriptome166Y
F055982Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0181525_100203251F009718AGGLAVRGSFLAGAPFTGPVILIGELALSVNDSGDGVINGHIAGSENGTILTFAEEPVTGSYSVDANCKGTLTVTPKGESVLNFSFVIVDSGEEMLAIETDPDTVVSGTLVKGN*
Ga0181525_100203252F038327AGGAGMRRSRFISSTPLIAGLLTGLLFAIQVVPLNAADSDSWYDVSKEVTLTGTVSSVLHQPAPGMTWGSHLMVETVSGRLDASLGRFGLEGKGALSVTPGQQIELTGFMKTVRDKEVFVVRSVKANGITYTMRNEHGIEVSPLARERAAEKGVTL*
Ga0181525_100203254F055982GAGMGHRDIKTAMHYQHPEVETARAALDYRPPTTDAAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.