Scaffold Ga0180008_1213036

Overview

Basic Information

• Taxon OID: 3300014613
• Scaffold ID: Ga0180008_1213036
• Source Dataset Name: Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 741
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location

• Location Name: Sweden: Oskarshamn
• Coordinates
  • Lat. (^o): 57.4344
  • Long. (^o): 16.66
  • Depth (m): 171

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018007	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180008_12130362	F018007	AGG	MFNGWKITNILDVGPCELDTVDGPYSKTGYRLEHREDGFAVTVGLMEHITGWSVWEVLGWLNEKQAIPRRYDNAK