Scaffold Ga0182014_10113126

Overview

Basic Information

• Taxon OID: 3300014491
• Scaffold ID: Ga0182014_10113126
• Source Dataset Name: Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1605
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Stordalen
• Coordinates
  • Lat. (^o): 68.35
  • Long. (^o): 19.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063304	Metagenome	129	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182014_101131262	F063304	N/A	MRLNNSAPDRAVSPHVYNLLDQRLAQQGAPLHQLIRTYAAAVPAQPSSPEELLNQLTAVLGKWAADPAQRVKPETALAEEHLRLMDDINKIQGPEGATRLEATLVRLVANQFARNMGSALRIPDESKLICLSDVKPGNAYSAFAQRTALIGIQPHEWVKRWVESQRDLFRNKPSDAGYLRLAQRLSGARPLETGKGDAFQRTLATFLDGIAASTSQSHAVVVQSSLLETFARAIRHQARDLGLDRPAAPSPAISVS*