Scaffold Ga0182018_10100673

Overview

Basic Information

• Taxon OID: 3300014489
• Scaffold ID: Ga0182018_10100673
• Source Dataset Name: Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1694
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Stordalen
• Coordinates
  • Lat. (^o): 68.35
  • Long. (^o): 19.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007636	Metagenome / Metatranscriptome	347	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182018_101006731	F007636	N/A	VSVPLERLAAGWAEGSDEIILRRCPVCEQDSIVGHGRRRKQAHDEHHDWIGIRRGRCIRCGKTFTFLPVFSLPYTHYSLLARCQALLRRFVEHCSWEKAAPKFKDADRLPDSSTVRRWSQGVDESQPALSFLRKTAARAAQWLESAYSHQDGTTFLSGLTPVLEVLCPMRC*