Scaffold Ga0182004_10292183

Overview

Basic Information

• Taxon OID: 3300014486
• Scaffold ID: Ga0182004_10292183
• Source Dataset Name: Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Root → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location

• Location Name: USA: Nebraska
• Coordinates
  • Lat. (^o): 41.1613
  • Long. (^o): -96.6752

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037171	Metagenome / Metatranscriptome	168	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182004_102921831	F037171	GGA	MYVCARIENDPVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPHYTFI