Scaffold Ga0172379_10000031

Overview

Basic Information

• Taxon OID: 3300014208
• Scaffold ID: Ga0172379_10000031
• Source Dataset Name: Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 355825
• Total Scaffold Genes: 559
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 331 (59.21%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales (Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 43.442
  • Long. (^o): -80.577

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103060	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172379_10000031377	F103060	N/A	MAIISPADLPAVLKIQSDPIKDYVFKKLGHPVVEVEITENQLETVIRSSGDFIAEYFPKEERYALFYTSPLKSTYPMPADAYWLREVAWDPSSTNIGDIFGAESYLFNIGNVTGITNILTDLHLLQAYRKFSRKILGTEGHWEVVNEVNGDSHDQLIRLYPTPKGAFPVVVRYLPFVTHFRSPQAKMICYEMIEAEAKIMLGHARRKIAGMPTPDGGGINYDGDALVQEGQKAKDEIIQKAIYLGEPMAVYLW*