Scaffold Ga0172380_10376800

Overview

Basic Information

• Taxon OID: 3300014205
• Scaffold ID: Ga0172380_10376800
• Source Dataset Name: Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1067
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 43.442
  • Long. (^o): -80.577

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089113	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172380_103768002	F089113	N/A	MPKLKNVDLSKKYFECQGRKFYLRDSLSFNRYRELQKLVLEFGYSATFVDIFKNLRIAWDHLNSQKLGEAAIILHNVMYGVRTLEDKDDAALRMCALFISEEGEDETVYDEGKMREKIDCWSKEYAVTPFFQLAATLVPSWINAYKIVSQSGLSKAEPQEQDQSQTQ*