Scaffold Ga0172381_10390583

Overview

Basic Information

• Taxon OID: 3300014204
• Scaffold ID: Ga0172381_10390583
• Source Dataset Name: Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1090
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → unclassified Coriobacteriaceae → Coriobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 43.442
  • Long. (^o): -80.577

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068574	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172381_103905832	F068574	GGAGG	MTICAMSYAESRLDHFKAVREKRKKTLHWWKYQKPGKQYGEQTIHVMCSDLGLEISYLDDVIQMLEKAGVEG*