Scaffold Ga0172378_11214565

Overview

Basic Information

• Taxon OID: 3300014203
• Scaffold ID: Ga0172378_11214565
• Source Dataset Name: Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → unclassified Spirochaetales → Spirochaetales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 43.442
  • Long. (^o): -80.577

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084270	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0172378_112145651	F084270	N/A	MPRQTNEKNLIFPDGFKLEISTDGTTGSTWEDVGVLAGGASLTFNWDEFYLDAGNYEGLVDKAINPTVALAPSAVWNFDPAVIKALFPGFFTSAAATSPETGTDITYAGTSNQVSLTRSKLRLTHYTDDALTTVDWQFTLHNAKIDAGASFNFKGVNEDGLDEITVSFTGKPDPAST