Scaffold Ga0134079_10173631

Overview

Basic Information

• Taxon OID: 3300014166
• Scaffold ID: Ga0134079_10173631
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 886
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Angelo Coastal Reserve, California
• Coordinates
  • Lat. (^o): 39.7181
  • Long. (^o): -123.6527
  • Depth (m): .4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026424	Metagenome / Metatranscriptome	198	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134079_101736311	F026424	GGAGG	MMNLSLAQVKKFGSEIQSLKNKHEKAIQKADDVIEQGVDSTLASATAFGLGIWQTRSDHQKLLGVPIDLAVGLAAHAAGFMGMGGKAAPYLHSVGNGALAAHFHTVGRGVGKEMREKAGLAPVAMSGEGPAEGGSNLSDDALLEMARRRG*