NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181532_10005456

Scaffold Ga0181532_10005456


Overview

Basic Information
Taxon OID3300014164 Open in IMG/M
Scaffold IDGa0181532_10005456 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10790
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).3 to .4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025234Metagenome / Metatranscriptome202Y
F060162Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0181532_1000545612F025234AGGAGGMRRDELRNADLLSEIVFLGSGVAVVIALLIVVVAALTSAAAMQ*
Ga0181532_100054567F060162AGGTGGMTTQVGWRELYQAALLELRPEELRKRIDDAERAIRQRIVELRHADSSSEEESRALDDALRGLQVLASTECKSPQSTLSGSTQTEVIS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.