NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181518_10000104

Scaffold Ga0181518_10000104


Overview

Basic Information
Taxon OID3300014156 Open in IMG/M
Scaffold IDGa0181518_10000104 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)90951
Total Scaffold Genes94 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (58.51%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).6 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049135Metagenome / Metatranscriptome147Y
F050946Metagenome / Metatranscriptome144Y
F069767Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0181518_1000010433F069767AGGAGMLKKALLAALLALSFFAALGIQGHAPPPECDPCPWVN*
Ga0181518_1000010470F049135AGGAVSEFNHIHIRDGDDWLCGRSMAFEDREVIRCEARDPDEDEACRRCSDQILSYFGAPMHVQ
Ga0181518_1000010471F050946N/AMRQFWHSLAAVLLGNAVYFGLDRYLPPAGRHVPYKIDWGLAIDFWCCLVFYGLLARLKWFRSK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.