Scaffold Ga0181539_1018228

Overview

Basic Information

• Taxon OID: 3300014151
• Scaffold ID: Ga0181539_1018228
• Source Dataset Name: Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4078
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 47.1149
  • Long. (^o): -88.5476
  • Depth (m): .6 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092530	Metagenome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0181539_10182281	F092530	AGG	LGAITVVCLMPALRKDYAQLHWRTSLFAMIGACLIYPPAILVYTRKAIAQRNGDWKITIFILGLTYVLFRMVR*