Scaffold Ga0181613_1194221

Overview

Basic Information

• Taxon OID: 3300014149
• Scaffold ID: Ga0181613_1194221
• Source Dataset Name: In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 621
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water → In Situ Water Column Microbial Community From The Vent Pool Of Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7101
  • Long. (^o): -110.7413
  • Depth (m): .05 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022102	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181613_11942211	F022102	GGA	MQDICPSTHKNAHIYIRCLHDACKLLGGEHRLAEYLGVDVRSIDDWLNGRGHPPDSVFLRCTDLLQSRGAR*