Scaffold Ga0134357_103547

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134357_103547

Scaffold Ga0134357_103547

Overview

Basic Information
Taxon OID	3300014107 Open in IMG/M
Scaffold ID	Ga0134357_103547 Open in IMG/M
Source Dataset Name	Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_014
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The George Washington University (GWU)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1288
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location
Location Name	USA: Maryland
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097527	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134357_1035472	F097527	N/A	MIYFKMEKIGNSTHNKEKKTRSENLVFNTIPAAGG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.